$ cat recipes/copper-fall-brazilian-coconut-lime-pancake-plate-067964.md

Copper Fall Brazilian Coconut Lime Pancake Plate No. 067964

Name: Copper Fall Brazilian Coconut Lime Pancake Plate No. 067964
Prep time: 21 min
Cook time: 27 min
Total time: 48 min
Yield: 5 servings
Ingredients: copper fall brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Copper Fall Brazilian Coconut Lime Pancake Plate No. 067964 is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Copper Fall Brazilian Coconut Lime Pancake Plate No. 067964

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       21 min
cook       27 min
total      48 min
servings   5
protein    26 g
pantry     98/100

categorybreakfastdietpescatarianlevelmediumkcal631

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper fall brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.