$ cat recipes/copper-fall-indian-tomato-basil-oat-bake-063209.md

Copper Fall Indian Tomato Basil Oat Bake No. 063209

Name: Copper Fall Indian Tomato Basil Oat Bake No. 063209
Prep time: 12 min
Cook time: 30 min
Total time: 42 min
Yield: 5 servings
Ingredients: copper fall indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Copper Fall Indian Tomato Basil Oat Bake No. 063209 is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Copper Fall Indian Tomato Basil Oat Bake No. 063209

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       12 min
cook       30 min
total      42 min
servings   5
protein    39 g
pantry     68/100

categorybreakfastdietpescatarianleveleasykcal606

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper fall indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.