$ cat recipes/copper-fall-mediterranean-sesame-ginger-pancake-hash-069944.md

Copper Fall Mediterranean Sesame Ginger Pancake Hash No. 069944

Name: Copper Fall Mediterranean Sesame Ginger Pancake Hash No. 069944
Prep time: 21 min
Cook time: 17 min
Total time: 38 min
Yield: 5 servings
Ingredients: copper fall mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Copper Fall Mediterranean Sesame Ginger Pancake Hash No. 069944 is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

runnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Copper Fall Mediterranean Sesame Ginger Pancake Hash No. 069944

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       21 min
cook       17 min
total      38 min
servings   5
protein    8 g
pantry     66/100

categorybreakfastdietpescatarianleveleasykcal391

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper fall mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.