$ cat recipes/copper-fall-mexican-miso-scallion-scramble-cup-065889.md

Copper Fall Mexican Miso Scallion Scramble Cup No. 065889

Name: Copper Fall Mexican Miso Scallion Scramble Cup No. 065889
Prep time: 22 min
Cook time: 18 min
Total time: 40 min
Yield: 5 servings
Ingredients: copper fall mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Copper Fall Mexican Miso Scallion Scramble Cup No. 065889 is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Copper Fall Mexican Miso Scallion Scramble Cup No. 065889

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       22 min
cook       18 min
total      40 min
servings   5
protein    25 g
pantry     69/100

categorybreakfastdietpescatarianleveleasykcal296

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper fall mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.