$ cat recipes/copper-holiday-japanese-sweet-potato-oat-bake-060259.md

Copper Holiday Japanese Sweet Potato Oat Bake No. 060259

Name: Copper Holiday Japanese Sweet Potato Oat Bake No. 060259
Prep time: 6 min
Cook time: 14 min
Total time: 20 min
Yield: 5 servings
Ingredients: copper holiday japanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Copper Holiday Japanese Sweet Potato Oat Bake No. 060259 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Copper Holiday Japanese Sweet Potato Oat Bake No. 060259

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       6 min
cook       14 min
total      20 min
servings   5
protein    33 g
pantry     90/100

categorybreakfastdietpescatarianleveleasykcal236

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper holiday japanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.