$ cat recipes/copper-holiday-taiwanese-corn-pepper-smoothie-stack-068179.md

Copper Holiday Taiwanese Corn Pepper Smoothie Stack No. 068179

Name: Copper Holiday Taiwanese Corn Pepper Smoothie Stack No. 068179
Prep time: 6 min
Cook time: 12 min
Total time: 18 min
Yield: 5 servings
Ingredients: copper holiday taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Copper Holiday Taiwanese Corn Pepper Smoothie Stack No. 068179 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Copper Holiday Taiwanese Corn Pepper Smoothie Stack No. 068179

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       6 min
cook       12 min
total      18 min
servings   5
protein    37 g
pantry     85/100

categorybreakfastdietpescatarianleveleasykcal256

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper holiday taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.