$ cat recipes/copper-late-night-brazilian-lemon-herb-egg-muffin-bake-061554.md

Copper Late-Night Brazilian Lemon Herb Egg Muffin Bake No. 061554

Name: Copper Late-Night Brazilian Lemon Herb Egg Muffin Bake No. 061554
Prep time: 19 min
Cook time: 35 min
Total time: 54 min
Yield: 5 servings
Ingredients: copper late-night brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Copper Late-Night Brazilian Lemon Herb Egg Muffin Bake No. 061554 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Copper Late-Night Brazilian Lemon Herb Egg Muffin Bake No. 061554

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       19 min
cook       35 min
total      54 min
servings   5
protein    10 g
pantry     67/100

categorybreakfastdietpescatarianleveleasykcal621

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper late-night brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.