$ cat recipes/copper-late-night-korean-sweet-potato-overnight-oat-plate-065619.md

Copper Late-Night Korean Sweet Potato Overnight Oat Plate No. 065619

Name: Copper Late-Night Korean Sweet Potato Overnight Oat Plate No. 065619
Prep time: 26 min
Cook time: 28 min
Total time: 54 min
Yield: 5 servings
Ingredients: copper late-night korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Copper Late-Night Korean Sweet Potato Overnight Oat Plate No. 065619 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Copper Late-Night Korean Sweet Potato Overnight Oat Plate No. 065619

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       26 min
cook       28 min
total      54 min
servings   5
protein    43 g
pantry     92/100

categorybreakfastdietpescatarianlevelmediumkcal596

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper late-night korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.