$ cat recipes/copper-late-night-taiwanese-coconut-lime-pancake-plate-060964.md

Copper Late-Night Taiwanese Coconut Lime Pancake Plate No. 060964

Name: Copper Late-Night Taiwanese Coconut Lime Pancake Plate No. 060964
Prep time: 9 min
Cook time: 9 min
Total time: 18 min
Yield: 5 servings
Ingredients: copper late-night taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Copper Late-Night Taiwanese Coconut Lime Pancake Plate No. 060964 is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Copper Late-Night Taiwanese Coconut Lime Pancake Plate No. 060964

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       9 min
cook       9 min
total      18 min
servings   5
protein    24 g
pantry     96/100

categorybreakfastdietpescatarianlevelmediumkcal351

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper late-night taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.