$ cat recipes/copper-lunchbox-british-spinach-feta-oat-stack-060774.md

Copper Lunchbox British Spinach Feta Oat Stack No. 060774

Name: Copper Lunchbox British Spinach Feta Oat Stack No. 060774
Prep time: 11 min
Cook time: 9 min
Total time: 20 min
Yield: 5 servings
Ingredients: copper lunchbox british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Copper Lunchbox British Spinach Feta Oat Stack No. 060774 is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Copper Lunchbox British Spinach Feta Oat Stack No. 060774

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       11 min
cook       9 min
total      20 min
servings   5
protein    24 g
pantry     97/100

categorybreakfastdietpescatarianleveleasykcal671

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper lunchbox british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.