$ cat recipes/copper-lunchbox-korean-spinach-feta-pancake-bake-062954.md

Copper Lunchbox Korean Spinach Feta Pancake Bake No. 062954

Name: Copper Lunchbox Korean Spinach Feta Pancake Bake No. 062954
Prep time: 17 min
Cook time: 31 min
Total time: 48 min
Yield: 5 servings
Ingredients: copper lunchbox korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Copper Lunchbox Korean Spinach Feta Pancake Bake No. 062954 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Copper Lunchbox Korean Spinach Feta Pancake Bake No. 062954

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       17 min
cook       31 min
total      48 min
servings   5
protein    18 g
pantry     92/100

categorybreakfastdietpescatarianleveleasykcal481

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper lunchbox korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.