$ cat recipes/copper-market-day-french-tomato-basil-pancake-cup-060489.md

Copper Market-Day French Tomato Basil Pancake Cup No. 060489

Name: Copper Market-Day French Tomato Basil Pancake Cup No. 060489
Prep time: 14 min
Cook time: 28 min
Total time: 42 min
Yield: 5 servings
Ingredients: copper market-day french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Copper Market-Day French Tomato Basil Pancake Cup No. 060489 is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Copper Market-Day French Tomato Basil Pancake Cup No. 060489

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       14 min
cook       28 min
total      42 min
servings   5
protein    43 g
pantry     78/100

categorybreakfastdietpescatarianleveleasykcal416

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper market-day french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.