$ cat recipes/copper-market-day-korean-sweet-potato-toast-stack-066529.md

Copper Market-Day Korean Sweet Potato Toast Stack No. 066529

Name: Copper Market-Day Korean Sweet Potato Toast Stack No. 066529
Prep time: 6 min
Cook time: 14 min
Total time: 20 min
Yield: 5 servings
Ingredients: copper market-day korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Copper Market-Day Korean Sweet Potato Toast Stack No. 066529 is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Copper Market-Day Korean Sweet Potato Toast Stack No. 066529

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       6 min
cook       14 min
total      20 min
servings   5
protein    33 g
pantry     98/100

categorybreakfastdietpescatarianlevelmediumkcal456

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper market-day korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.