$ cat recipes/copper-rainy-day-japanese-corn-pepper-egg-bake-069359.md

Copper Rainy-Day Japanese Corn Pepper Egg Bake No. 069359

Name: Copper Rainy-Day Japanese Corn Pepper Egg Bake No. 069359
Prep time: 26 min
Cook time: 26 min
Total time: 52 min
Yield: 5 servings
Ingredients: copper rainy-day japanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Copper Rainy-Day Japanese Corn Pepper Egg Bake No. 069359 is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Copper Rainy-Day Japanese Corn Pepper Egg Bake No. 069359

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       26 min
cook       26 min
total      52 min
servings   5
protein    9 g
pantry     68/100

categorybreakfastdietpescatarianleveleasykcal306

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper rainy-day japanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.