$ cat recipes/copper-rainy-day-korean-coconut-lime-smoothie-hash-065694.md

Copper Rainy-Day Korean Coconut Lime Smoothie Hash No. 065694

Name: Copper Rainy-Day Korean Coconut Lime Smoothie Hash No. 065694
Prep time: 9 min
Cook time: 21 min
Total time: 30 min
Yield: 5 servings
Ingredients: copper rainy-day korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Copper Rainy-Day Korean Coconut Lime Smoothie Hash No. 065694 is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Copper Rainy-Day Korean Coconut Lime Smoothie Hash No. 065694

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       9 min
cook       21 min
total      30 min
servings   5
protein    38 g
pantry     97/100

categorybreakfastdietpescatarianleveleasykcal431

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper rainy-day korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.