$ cat recipes/copper-rainy-day-mexican-sesame-ginger-overnight-oat-stack-062124.md

Copper Rainy-Day Mexican Sesame Ginger Overnight Oat Stack No. 062124

Name: Copper Rainy-Day Mexican Sesame Ginger Overnight Oat Stack No. 062124
Prep time: 13 min
Cook time: 35 min
Total time: 48 min
Yield: 5 servings
Ingredients: copper rainy-day mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Copper Rainy-Day Mexican Sesame Ginger Overnight Oat Stack No. 062124 is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Copper Rainy-Day Mexican Sesame Ginger Overnight Oat Stack No. 062124

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       13 min
cook       35 min
total      48 min
servings   5
protein    10 g
pantry     64/100

categorybreakfastdietpescatarianleveleasykcal641

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper rainy-day mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.