$ cat recipes/copper-spring-brazilian-sweet-potato-smoothie-plate-065169.md

Copper Spring Brazilian Sweet Potato Smoothie Plate No. 065169

Name: Copper Spring Brazilian Sweet Potato Smoothie Plate No. 065169
Prep time: 18 min
Cook time: 32 min
Total time: 50 min
Yield: 5 servings
Ingredients: copper spring brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Copper Spring Brazilian Sweet Potato Smoothie Plate No. 065169 is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Copper Spring Brazilian Sweet Potato Smoothie Plate No. 065169

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       18 min
cook       32 min
total      50 min
servings   5
protein    35 g
pantry     62/100

categorybreakfastdietpescatarianleveleasykcal606

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper spring brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.