$ cat recipes/copper-spring-japanese-coconut-lime-egg-stack-064874.md

Copper Spring Japanese Coconut Lime Egg Stack No. 064874

Name: Copper Spring Japanese Coconut Lime Egg Stack No. 064874
Prep time: 13 min
Cook time: 19 min
Total time: 32 min
Yield: 5 servings
Ingredients: copper spring japanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Copper Spring Japanese Coconut Lime Egg Stack No. 064874 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Copper Spring Japanese Coconut Lime Egg Stack No. 064874

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       13 min
cook       19 min
total      32 min
servings   5
protein    42 g
pantry     97/100

categorybreakfastdietpescatarianleveleasykcal471

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper spring japanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.