$ cat recipes/copper-summer-british-coconut-lime-egg-muffin-bake-062504.md

Copper Summer British Coconut Lime Egg Muffin Bake No. 062504

Name: Copper Summer British Coconut Lime Egg Muffin Bake No. 062504
Prep time: 9 min
Cook time: 35 min
Total time: 44 min
Yield: 5 servings
Ingredients: copper summer british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Copper Summer British Coconut Lime Egg Muffin Bake No. 062504 is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Copper Summer British Coconut Lime Egg Muffin Bake No. 062504

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       9 min
cook       35 min
total      44 min
servings   5
protein    10 g
pantry     62/100

categorybreakfastdietpescatarianlevelmediumkcal491

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper summer british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.