$ cat recipes/copper-summer-korean-sesame-ginger-overnight-oat-stack-065679.md

Copper Summer Korean Sesame Ginger Overnight Oat Stack No. 065679

Name: Copper Summer Korean Sesame Ginger Overnight Oat Stack No. 065679
Prep time: 8 min
Cook time: 30 min
Total time: 38 min
Yield: 5 servings
Ingredients: copper summer korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Copper Summer Korean Sesame Ginger Overnight Oat Stack No. 065679 is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Copper Summer Korean Sesame Ginger Overnight Oat Stack No. 065679

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       8 min
cook       30 min
total      38 min
servings   5
protein    39 g
pantry     96/100

categorybreakfastdietpescatarianleveleasykcal366

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper summer korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.