$ cat recipes/copper-sunday-brazilian-sweet-potato-oat-bake-064259.md

Copper Sunday Brazilian Sweet Potato Oat Bake No. 064259

Name: Copper Sunday Brazilian Sweet Potato Oat Bake No. 064259
Prep time: 16 min
Cook time: 8 min
Total time: 24 min
Yield: 5 servings
Ingredients: copper sunday brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Copper Sunday Brazilian Sweet Potato Oat Bake No. 064259 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Copper Sunday Brazilian Sweet Potato Oat Bake No. 064259

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       16 min
cook       8 min
total      24 min
servings   5
protein    7 g
pantry     97/100

categorybreakfastdietpescatarianleveleasykcal256

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper sunday brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.