$ cat recipes/copper-sunday-ontario-sweet-potato-pancake-cup-066439.md

Copper Sunday Ontario Sweet Potato Pancake Cup No. 066439

Name: Copper Sunday Ontario Sweet Potato Pancake Cup No. 066439
Prep time: 22 min
Cook time: 30 min
Total time: 52 min
Yield: 5 servings
Ingredients: copper sunday ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Copper Sunday Ontario Sweet Potato Pancake Cup No. 066439 is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Copper Sunday Ontario Sweet Potato Pancake Cup No. 066439

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       22 min
cook       30 min
total      52 min
servings   5
protein    39 g
pantry     92/100

categorybreakfastdietpescatarianleveleasykcal556

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper sunday ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.