$ cat recipes/copper-sunday-taiwanese-corn-pepper-pancake-hash-065449.md

Copper Sunday Taiwanese Corn Pepper Pancake Hash No. 065449

Name: Copper Sunday Taiwanese Corn Pepper Pancake Hash No. 065449
Prep time: 22 min
Cook time: 16 min
Total time: 38 min
Yield: 5 servings
Ingredients: copper sunday taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Copper Sunday Taiwanese Corn Pepper Pancake Hash No. 065449 is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Copper Sunday Taiwanese Corn Pepper Pancake Hash No. 065449

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       22 min
cook       16 min
total      38 min
servings   5
protein    29 g
pantry     67/100

categorybreakfastdietpescatarianleveleasykcal676

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper sunday taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.