$ cat recipes/copper-winter-indian-garlic-butter-egg-cup-062389.md

Copper Winter Indian Garlic Butter Egg Cup No. 062389

Name: Copper Winter Indian Garlic Butter Egg Cup No. 062389
Prep time: 16 min
Cook time: 28 min
Total time: 44 min
Yield: 5 servings
Ingredients: copper winter indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Copper Winter Indian Garlic Butter Egg Cup No. 062389 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Copper Winter Indian Garlic Butter Egg Cup No. 062389

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       16 min
cook       28 min
total      44 min
servings   5
protein    43 g
pantry     68/100

categorybreakfastdietpescatarianleveleasykcal646

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper winter indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.