$ cat recipes/copper-winter-indian-garlic-butter-egg-cup-067834.md

Copper Winter Indian Garlic Butter Egg Cup No. 067834

Name: Copper Winter Indian Garlic Butter Egg Cup No. 067834
Prep time: 27 min
Cook time: 29 min
Total time: 56 min
Yield: 5 servings
Ingredients: copper winter indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Copper Winter Indian Garlic Butter Egg Cup No. 067834 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Copper Winter Indian Garlic Butter Egg Cup No. 067834

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       27 min
cook       29 min
total      56 min
servings   5
protein    22 g
pantry     62/100

categorybreakfastdietpescatarianleveleasykcal231

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

copper winter indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.