mdrecipesmd.com
back to 10k

$ cat recipes/fall-korean-corn-pepper-egg-bake-3804.md

Fall Korean Corn Pepper Egg Bake

^_^ cozy - Fall Korean Corn Pepper Egg Bake is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

categorybreakfastdietpescatarianleveleasykcal271

$ price recipe --region auto

Estimating local basket...

Ingredients

  • fall korean corn
  • rolled oats
  • parsley
  • cumin
  • olive oil
  • kosher salt
  • black pepper
  • garlic
  • lemon

Steps

  1. Prep all vegetables, aromatics, and protein before heat touches the pan.
  2. Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
  3. Add liquid or sauce in stages, tasting once midway and once before serving.
  4. Plate hot with herbs, acid, and a final grind of pepper.