$ cat recipes/fall-mediterranean-sesame-ginger-pancake-hash-4499.md

Fall Mediterranean Sesame Ginger Pancake Hash

Name: Fall Mediterranean Sesame Ginger Pancake Hash
Prep time: 14 min
Cook time: 30 min
Total time: 44 min
Yield: 5 servings
Ingredients: fall mediterranean sesame; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Fall Mediterranean Sesame Ginger Pancake Hash is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Fall Mediterranean Sesame Ginger Pancake Hash

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       14 min
cook       30 min
total      44 min
servings   5
protein    39 g
pantry     90/100

categorybreakfastdietpescatarianleveleasykcal506

$ price recipe --region auto

Estimating local basket...

Ingredients

fall mediterranean sesame
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.