$ cat recipes/fall-mexican-lemon-herb-toast-bake-3004.md

Fall Mexican Lemon Herb Toast Bake

Name: Fall Mexican Lemon Herb Toast Bake
Prep time: 17 min
Cook time: 15 min
Total time: 32 min
Yield: 5 servings
Ingredients: fall mexican lemon; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Fall Mexican Lemon Herb Toast Bake is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Fall Mexican Lemon Herb Toast Bake

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       17 min
cook       15 min
total      32 min
servings   5
protein    12 g
pantry     86/100

categorybreakfastdietpescatarianlevelmediumkcal561

$ price recipe --region auto

Estimating local basket...

Ingredients

fall mexican lemon
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.