$ cat recipes/fall-ontario-sweet-potato-breakfast-wrap-bake-3709.md

Fall Ontario Sweet Potato Breakfast Wrap Bake

Name: Fall Ontario Sweet Potato Breakfast Wrap Bake
Prep time: 20 min
Cook time: 10 min
Total time: 30 min
Yield: 5 servings
Ingredients: fall ontario sweet; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Fall Ontario Sweet Potato Breakfast Wrap Bake is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Fall Ontario Sweet Potato Breakfast Wrap Bake

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       20 min
cook       10 min
total      30 min
servings   5
protein    41 g
pantry     92/100

categorybreakfastdietpescatarianleveleasykcal676

$ price recipe --region auto

Estimating local basket...

Ingredients

fall ontario sweet
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.