$ cat recipes/field-fall-french-coconut-lime-egg-stack-041329.md

Field Fall French Coconut Lime Egg Stack

Name: Field Fall French Coconut Lime Egg Stack
Prep time: 20 min
Cook time: 10 min
Total time: 30 min
Yield: 5 servings
Ingredients: field fall french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Fall French Coconut Lime Egg Stack is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Field Fall French Coconut Lime Egg Stack

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       20 min
cook       10 min
total      30 min
servings   5
protein    41 g
pantry     58/100

categorybreakfastdietpescatarianlevelmediumkcal526

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field fall french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.