$ cat recipes/field-fall-french-sesame-ginger-breakfast-wrap-plate-042214.md

Field Fall French Sesame Ginger Breakfast Wrap Plate

Name: Field Fall French Sesame Ginger Breakfast Wrap Plate
Prep time: 13 min
Cook time: 11 min
Total time: 24 min
Yield: 5 servings
Ingredients: field fall french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Field Fall French Sesame Ginger Breakfast Wrap Plate is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Fall French Sesame Ginger Breakfast Wrap Plate

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       13 min
cook       11 min
total      24 min
servings   5
protein    20 g
pantry     76/100

categorybreakfastdietpescatarianleveleasykcal441

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field fall french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.