$ cat recipes/field-fall-ontario-coconut-lime-overnight-oat-hash-044699.md

Field Fall Ontario Coconut Lime Overnight Oat Hash

Name: Field Fall Ontario Coconut Lime Overnight Oat Hash
Prep time: 10 min
Cook time: 40 min
Total time: 50 min
Yield: 5 servings
Ingredients: field fall ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Fall Ontario Coconut Lime Overnight Oat Hash is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Fall Ontario Coconut Lime Overnight Oat Hash

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       10 min
cook       40 min
total      50 min
servings   5
protein    19 g
pantry     64/100

categorybreakfastdietpescatarianleveleasykcal266

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field fall ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.