$ cat recipes/field-fall-taiwanese-tomato-basil-pancake-cup-040934.md

Field Fall Taiwanese Tomato Basil Pancake Cup

Name: Field Fall Taiwanese Tomato Basil Pancake Cup
Prep time: 23 min
Cook time: 19 min
Total time: 42 min
Yield: 5 servings
Ingredients: field fall taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Field Fall Taiwanese Tomato Basil Pancake Cup is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Field Fall Taiwanese Tomato Basil Pancake Cup

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       23 min
cook       19 min
total      42 min
servings   5
protein    42 g
pantry     59/100

categorybreakfastdietpescatarianleveleasykcal611

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field fall taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.