$ cat recipes/field-holiday-brazilian-pesto-kale-toast-hash-041549.md

Field Holiday Brazilian Pesto Kale Toast Hash

Name: Field Holiday Brazilian Pesto Kale Toast Hash
Prep time: 20 min
Cook time: 30 min
Total time: 50 min
Yield: 5 servings
Ingredients: field holiday brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Holiday Brazilian Pesto Kale Toast Hash is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Field Holiday Brazilian Pesto Kale Toast Hash

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       20 min
cook       30 min
total      50 min
servings   5
protein    39 g
pantry     59/100

categorybreakfastdietpescatarianleveleasykcal336

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field holiday brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.