$ cat recipes/field-holiday-french-coconut-lime-oat-cup-042239.md

Field Holiday French Coconut Lime Oat Cup

Name: Field Holiday French Coconut Lime Oat Cup
Prep time: 22 min
Cook time: 34 min
Total time: 56 min
Yield: 5 servings
Ingredients: field holiday french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Holiday French Coconut Lime Oat Cup is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerweight-lossathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Field Holiday French Coconut Lime Oat Cup

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       22 min
cook       34 min
total      56 min
servings   5
protein    31 g
pantry     64/100

categorybreakfastdietpescatarianlevelmediumkcal386

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field holiday french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.