$ cat recipes/field-holiday-french-sweet-potato-egg-hash-046894.md

Field Holiday French Sweet Potato Egg Hash

Name: Field Holiday French Sweet Potato Egg Hash
Prep time: 17 min
Cook time: 15 min
Total time: 32 min
Yield: 5 servings
Ingredients: field holiday french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Field Holiday French Sweet Potato Egg Hash is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Holiday French Sweet Potato Egg Hash

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       17 min
cook       15 min
total      32 min
servings   5
protein    12 g
pantry     60/100

categorybreakfastdietpescatarianlevelmediumkcal631

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field holiday french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.