$ cat recipes/field-holiday-korean-tomato-basil-pancake-cup-042934.md

Field Holiday Korean Tomato Basil Pancake Cup

Name: Field Holiday Korean Tomato Basil Pancake Cup
Prep time: 17 min
Cook time: 35 min
Total time: 52 min
Yield: 5 servings
Ingredients: field holiday korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Field Holiday Korean Tomato Basil Pancake Cup is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Holiday Korean Tomato Basil Pancake Cup

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       17 min
cook       35 min
total      52 min
servings   5
protein    10 g
pantry     83/100

categorybreakfastdietpescatarianleveleasykcal621

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field holiday korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.