$ cat recipes/field-holiday-mediterranean-garlic-butter-breakfast-wrap-hash-041749.md

Field Holiday Mediterranean Garlic Butter Breakfast Wrap Hash

Name: Field Holiday Mediterranean Garlic Butter Breakfast Wrap Hash
Prep time: 26 min
Cook time: 24 min
Total time: 50 min
Yield: 5 servings
Ingredients: field holiday mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Holiday Mediterranean Garlic Butter Breakfast Wrap Hash is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Holiday Mediterranean Garlic Butter Breakfast Wrap Hash

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       26 min
cook       24 min
total      50 min
servings   5
protein    13 g
pantry     86/100

categorybreakfastdietpescatarianlevelmediumkcal386

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field holiday mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.