$ cat recipes/field-holiday-mediterranean-sweet-potato-toast-stack-048074.md

Field Holiday Mediterranean Sweet Potato Toast Stack

Name: Field Holiday Mediterranean Sweet Potato Toast Stack
Prep time: 15 min
Cook time: 29 min
Total time: 44 min
Yield: 5 servings
Ingredients: field holiday mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Field Holiday Mediterranean Sweet Potato Toast Stack is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Holiday Mediterranean Sweet Potato Toast Stack

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       15 min
cook       29 min
total      44 min
servings   5
protein    22 g
pantry     84/100

categorybreakfastdietpescatarianleveleasykcal191

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field holiday mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.