$ cat recipes/field-holiday-mexican-lemon-herb-pancake-plate-044914.md

Field Holiday Mexican Lemon Herb Pancake Plate

Name: Field Holiday Mexican Lemon Herb Pancake Plate
Prep time: 17 min
Cook time: 25 min
Total time: 42 min
Yield: 5 servings
Ingredients: field holiday mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Field Holiday Mexican Lemon Herb Pancake Plate is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerweight-lossathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Field Holiday Mexican Lemon Herb Pancake Plate

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       17 min
cook       25 min
total      42 min
servings   5
protein    30 g
pantry     92/100

categorybreakfastdietpescatarianleveleasykcal381

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field holiday mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.