$ cat recipes/field-holiday-taiwanese-tomato-basil-egg-hash-041844.md

Field Holiday Taiwanese Tomato Basil Egg Hash

Name: Field Holiday Taiwanese Tomato Basil Egg Hash
Prep time: 25 min
Cook time: 43 min
Total time: 68 min
Yield: 5 servings
Ingredients: field holiday taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Field Holiday Taiwanese Tomato Basil Egg Hash is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Field Holiday Taiwanese Tomato Basil Egg Hash

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       25 min
cook       43 min
total      68 min
servings   5
protein    32 g
pantry     65/100

categorybreakfastdietpescatarianleveleasykcal471

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field holiday taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.