$ cat recipes/field-late-night-brazilian-corn-pepper-pancake-hash-042449.md

Field Late-Night Brazilian Corn Pepper Pancake Hash

Name: Field Late-Night Brazilian Corn Pepper Pancake Hash
Prep time: 14 min
Cook time: 22 min
Total time: 36 min
Yield: 5 servings
Ingredients: field late-night brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Late-Night Brazilian Corn Pepper Pancake Hash is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Late-Night Brazilian Corn Pepper Pancake Hash

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       14 min
cook       22 min
total      36 min
servings   5
protein    17 g
pantry     78/100

categorybreakfastdietpescatarianlevelmediumkcal316

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field late-night brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.