$ cat recipes/field-late-night-brazilian-spinach-feta-oat-stack-044229.md

Field Late-Night Brazilian Spinach Feta Oat Stack

Name: Field Late-Night Brazilian Spinach Feta Oat Stack
Prep time: 8 min
Cook time: 18 min
Total time: 26 min
Yield: 5 servings
Ingredients: field late-night brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Late-Night Brazilian Spinach Feta Oat Stack is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Late-Night Brazilian Spinach Feta Oat Stack

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       8 min
cook       18 min
total      26 min
servings   5
protein    25 g
pantry     60/100

categorybreakfastdietpescatarianleveleasykcal516

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field late-night brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.