$ cat recipes/field-late-night-indian-coconut-lime-oat-cup-043239.md

Field Late-Night Indian Coconut Lime Oat Cup

Name: Field Late-Night Indian Coconut Lime Oat Cup
Prep time: 8 min
Cook time: 42 min
Total time: 50 min
Yield: 5 servings
Ingredients: field late-night indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Late-Night Indian Coconut Lime Oat Cup is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Late-Night Indian Coconut Lime Oat Cup

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       8 min
cook       42 min
total      50 min
servings   5
protein    15 g
pantry     76/100

categorybreakfastdietpescatarianleveleasykcal636

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field late-night indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.