$ cat recipes/field-late-night-mexican-garlic-butter-yogurt-cup-stack-044929.md

Field Late-Night Mexican Garlic Butter Yogurt Cup Stack

Name: Field Late-Night Mexican Garlic Butter Yogurt Cup Stack
Prep time: 18 min
Cook time: 16 min
Total time: 34 min
Yield: 5 servings
Ingredients: field late-night mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Late-Night Mexican Garlic Butter Yogurt Cup Stack is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerathleterunnerhousehold-of-4pescatarianhigh-proteingluten-freehalal-friendly

Recipe report: Field Late-Night Mexican Garlic Butter Yogurt Cup Stack

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       18 min
cook       16 min
total      34 min
servings   5
protein    29 g
pantry     93/100

categorybreakfastdietpescatarianleveleasykcal446

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field late-night mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.