$ cat recipes/field-late-night-taiwanese-sesame-ginger-egg-bake-041854.md

Field Late-Night Taiwanese Sesame Ginger Egg Bake

Name: Field Late-Night Taiwanese Sesame Ginger Egg Bake
Prep time: 11 min
Cook time: 37 min
Total time: 48 min
Yield: 5 servings
Ingredients: field late-night taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Field Late-Night Taiwanese Sesame Ginger Egg Bake is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Field Late-Night Taiwanese Sesame Ginger Egg Bake

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       11 min
cook       37 min
total      48 min
servings   5
protein    44 g
pantry     93/100

categorybreakfastdietpescatarianlevelmediumkcal351

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field late-night taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.