$ cat recipes/field-lunchbox-british-spinach-feta-breakfast-wrap-stack-040779.md

Field Lunchbox British Spinach Feta Breakfast Wrap Stack

Name: Field Lunchbox British Spinach Feta Breakfast Wrap Stack
Prep time: 20 min
Cook time: 36 min
Total time: 56 min
Yield: 5 servings
Ingredients: field lunchbox british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Lunchbox British Spinach Feta Breakfast Wrap Stack is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Lunchbox British Spinach Feta Breakfast Wrap Stack

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       20 min
cook       36 min
total      56 min
servings   5
protein    27 g
pantry     76/100

categorybreakfastdietpescatarianleveleasykcal266

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field lunchbox british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.