$ cat recipes/field-lunchbox-british-tomato-basil-smoothie-plate-041664.md

Field Lunchbox British Tomato Basil Smoothie Plate

Name: Field Lunchbox British Tomato Basil Smoothie Plate
Prep time: 13 min
Cook time: 37 min
Total time: 50 min
Yield: 5 servings
Ingredients: field lunchbox british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Field Lunchbox British Tomato Basil Smoothie Plate is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Field Lunchbox British Tomato Basil Smoothie Plate

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       13 min
cook       37 min
total      50 min
servings   5
protein    44 g
pantry     94/100

categorybreakfastdietpescatarianleveleasykcal671

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field lunchbox british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.