$ cat recipes/field-lunchbox-korean-corn-pepper-smoothie-stack-040179.md
Field Lunchbox Korean Corn Pepper Smoothie Stack
-_- calm - Field Lunchbox Korean Corn Pepper Smoothie Stack is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.
trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free
categorybreakfastdietpescatarianleveleasykcal606
$ price recipe --region auto
Estimating local basket from the detected market...
Ingredients
- field lunchbox korean
- rolled oats
- parsley
- cumin
- olive oil
- kosher salt
- black pepper
- garlic
- lemon
Steps
- Prep all vegetables, aromatics, and protein before heat touches the pan.
- Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
- Add liquid or sauce in stages, tasting once midway and once before serving.
- Plate hot with herbs, acid, and a final grind of pepper.