$ cat recipes/field-lunchbox-korean-lemon-herb-breakfast-wrap-cup-044739.md

Field Lunchbox Korean Lemon Herb Breakfast Wrap Cup

Name: Field Lunchbox Korean Lemon Herb Breakfast Wrap Cup
Prep time: 20 min
Cook time: 16 min
Total time: 36 min
Yield: 5 servings
Ingredients: field lunchbox korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Lunchbox Korean Lemon Herb Breakfast Wrap Cup is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerweight-lossathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Field Lunchbox Korean Lemon Herb Breakfast Wrap Cup

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       20 min
cook       16 min
total      36 min
servings   5
protein    29 g
pantry     94/100

categorybreakfastdietpescatarianleveleasykcal276

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field lunchbox korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.